PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09039.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 247aa    MW: 27051.9 Da    PI: 8.846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09039.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.7e-173782147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             +g+W++eEd  l ++v ++G+++W++I+r++  gR++k+c++rw + 
  mrna09039.1-v1.0-hybrid 37 KGPWSAEEDRVLTRLVDRYGPRNWSLISRYIK-GRSGKSCRLRWCNQ 82
                             79*****************************9.***********985 PP

2Myb_DNA-binding54.52.6e-1791133347
                              SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              ++++ Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
  mrna09039.1-v1.0-hybrid  91 PFSQAEDEAILAAHARYGNR-WATIARLLP-GRTDNAVKNHWNST 133
                              79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.3653287IPR017930Myb domain
SuperFamilySSF466897.91E-3135130IPR009057Homeodomain-like
SMARTSM007173.7E-153685IPR001005SANT/Myb domain
PfamPF002491.6E-163782IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-233890IPR009057Homeodomain-like
CDDcd001672.72E-143981No hitNo description
SMARTSM007172.5E-1588136IPR001005SANT/Myb domain
PROSITE profilePS5129421.49488138IPR017930Myb domain
CDDcd001672.05E-1291134No hitNo description
PfamPF002494.2E-1491133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2291138IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MDANIAMNMC SSSTSTSDSS SSESSQPRNP NKAERIKGPW SAEEDRVLTR LVDRYGPRNW  60
SLISRYIKGR SGKSCRLRWC NQLSPTVQHR PFSQAEDEAI LAAHARYGNR WATIARLLPG  120
RTDNAVKNHW NSTLKRRVRE PQEHHGEGNI GNAAIEVMML GNGSSSASAA SGRNGSMDLD  180
DPLTELTLAT PGIGSSVVSA SEQQHHHRSS SESFPPAGFW DVMRGVIARE VRDYVSSSYT  240
ETSGLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A9e-43341381105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8285480.0FR828548.1 Rosa rugosa mRNA for putative MYB transcription factor (myb15 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004291141.10.0PREDICTED: transcription factor MYB44-like
TrEMBLF2QKY21e-142F2QKY2_R
STRINGGLYMA06G04010.16e-92(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.15e-57myb domain protein 73